Recombinant Human CYTH4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CYTH4-4069H
Product Overview : CYTH4 MS Standard C13 and N15-labeled recombinant protein (NP_037517) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the PSCD family of proteins, which have an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family function as GEPs for ADP-ribosylation factors (ARFs), which are guanine nucleotide-binding proteins involved in vesicular trafficking pathways. This protein exhibits GEP activity in vitro with ARF1 and ARF5, but is inactive with ARF6. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 45.7 kDa
AA Sequence : MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CYTH4 cytohesin 4 [ Homo sapiens (human) ]
Official Symbol CYTH4
Synonyms CYTH4; cytohesin 4; pleckstrin homology, Sec7 and coiled coil domains 4, pleckstrin homology, Sec7 and coiled/coil domains 4, PSCD4; cytohesin-4; CYT4; pleckstrin homology, Sec7 and coiled-coil domains 4; pleckstrin homology, Sec7 and coiled/coil domains 4; PH, SEC7 and coiled-coil domain-containing protein 4; PSCD4; DJ63G5.1;
Gene ID 27128
mRNA Refseq NM_013385
Protein Refseq NP_037517
MIM 606514
UniProt ID Q9UIA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYTH4 Products

Required fields are marked with *

My Review for All CYTH4 Products

Required fields are marked with *

0
cart-icon
0
compare icon