Recombinant Human CYTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CYTL1-1442H |
| Product Overview : | CYTL1 MS Standard C13 and N15-labeled recombinant protein (NP_061129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. |
| Molecular Mass : | 15.6 kDa |
| AA Sequence : | MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CYTL1 cytokine like 1 [ Homo sapiens (human) ] |
| Official Symbol | CYTL1 |
| Synonyms | CYTL1; cytokine like 1; C17; C4orf4; cytokine-like protein 1; cytokine-like protein C17 |
| Gene ID | 54360 |
| mRNA Refseq | NM_018659 |
| Protein Refseq | NP_061129 |
| MIM | 607930 |
| UniProt ID | Q9NRR1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYTL1 Products
Required fields are marked with *
My Review for All CYTL1 Products
Required fields are marked with *




