Recombinant Human CYTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CYTL1-1442H |
Product Overview : | CYTL1 MS Standard C13 and N15-labeled recombinant protein (NP_061129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CYTL1 cytokine like 1 [ Homo sapiens (human) ] |
Official Symbol | CYTL1 |
Synonyms | CYTL1; cytokine like 1; C17; C4orf4; cytokine-like protein 1; cytokine-like protein C17 |
Gene ID | 54360 |
mRNA Refseq | NM_018659 |
Protein Refseq | NP_061129 |
MIM | 607930 |
UniProt ID | Q9NRR1 |
◆ Recombinant Proteins | ||
CYTL1-996R | Recombinant Rhesus Macaque CYTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYTL1-0381H | Recombinant Human CYTL1 protein, hFc-tagged | +Inquiry |
CYTL1-1303H | Recombinant Human CYTL1 Protein, His-tagged | +Inquiry |
CYTL1-711H | Recombinant Human CYTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYTL1-563H | Recombinant Human CYTL1 protein(Met1-Arg136), mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYTL1-7091HCL | Recombinant Human CYTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYTL1 Products
Required fields are marked with *
My Review for All CYTL1 Products
Required fields are marked with *