Recombinant Human Cytomegalovirus UL128 Protein (1-171 aa), His-tagged
Cat.No. : | UL128-2479H |
Product Overview : | Recombinant Human Cytomegalovirus (strain AD169) (HHV-5) (HCMV) UL128 Protein (1-171 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Cytomegalovirus |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-171 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.7 kDa |
AA Sequence : | MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | UL128; |
UniProt ID | P16837 |
◆ Recombinant Proteins | ||
UL128-1783C | Recombinant CMV (strain AD169) UL128 Protein | +Inquiry |
UL128-2151H | Recombinant Human Cytomegalovirus UL128 Protein (1-171 aa), His-tagged | +Inquiry |
UL128-5602H | Recombinant HCMV UL128 protein | +Inquiry |
UL128-2479H | Recombinant Human Cytomegalovirus UL128 Protein (1-171 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UL128 Products
Required fields are marked with *
My Review for All UL128 Products
Required fields are marked with *
0
Inquiry Basket