Recombinant Human Cytomegalovirus UL128 Protein (1-171 aa), His-tagged
| Cat.No. : | UL128-2479H |
| Product Overview : | Recombinant Human Cytomegalovirus (strain AD169) (HHV-5) (HCMV) UL128 Protein (1-171 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human Cytomegalovirus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-171 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Synonyms | UL128; |
| UniProt ID | P16837 |
| ◆ Recombinant Proteins | ||
| UL128-5602H | Recombinant HCMV UL128 protein | +Inquiry |
| UL128-2479H | Recombinant Human Cytomegalovirus UL128 Protein (1-171 aa), His-tagged | +Inquiry |
| UL128-1783C | Recombinant CMV (strain AD169) UL128 Protein | +Inquiry |
| UL128-2151H | Recombinant Human Cytomegalovirus UL128 Protein (1-171 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UL128 Products
Required fields are marked with *
My Review for All UL128 Products
Required fields are marked with *
