Recombinant Human DAAM1 Protein, GST-tagged
| Cat.No. : | DAAM1-2312H |
| Product Overview : | Human DAAM1 partial ORF ( NP_055807, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cell motility, adhesion, cytokinesis, and other functions of the cell cortex are mediated by reorganization of the actin cytoskeleton and several formin homology (FH) proteins have been associated with these processes. The protein encoded by this gene contains two FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. A key regulator of cytoskeletal architecture, the small GTPase Rho, is activated during development by Wnt/Fz signaling to control cell polarity and movement. The protein encoded by this gene is thought to function as a scaffolding protein for the Wnt-induced assembly of a disheveled (Dvl)-Rho complex. This protein also promotes the nucleation and elongation of new actin filaments and regulates cell growth through the stabilization of microtubules. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2012] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAAM1 dishevelled associated activator of morphogenesis 1 [ Homo sapiens ] |
| Official Symbol | DAAM1 |
| Synonyms | DAAM1; dishevelled associated activator of morphogenesis 1; disheveled-associated activator of morphogenesis 1; KIAA0666; FLJ41657; |
| Gene ID | 23002 |
| mRNA Refseq | NM_014992 |
| Protein Refseq | NP_055807 |
| MIM | 606626 |
| UniProt ID | Q9Y4D1 |
| ◆ Recombinant Proteins | ||
| Daam1-2444M | Recombinant Mouse Daam1 Protein, Myc/DDK-tagged | +Inquiry |
| DAAM1-989H | Recombinant Human DAAM1 Protein, MYC/DDK-tagged | +Inquiry |
| DAAM1-1172R | Recombinant Rhesus monkey DAAM1 Protein, His-tagged | +Inquiry |
| DAAM1-713H | Recombinant Human DAAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DAAM1-671H | Recombinant Human DAAM1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DAAM1-2111HCL | Recombinant Human DAAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAAM1 Products
Required fields are marked with *
My Review for All DAAM1 Products
Required fields are marked with *
