Recombinant Human DAB1 protein, His-tagged
Cat.No. : | DAB1-4643H |
Product Overview : | Recombinant Human DAB1 protein(O75553)(1-588 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-588 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 70.7 kDa |
AASequence : | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | DAB1 disabled homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | DAB1 |
Synonyms | DAB1; disabled homolog 1 (Drosophila); disabled (Drosophila) homolog 1; disabled homolog 1; |
Gene ID | 1600 |
mRNA Refseq | NM_021080 |
Protein Refseq | NP_066566 |
MIM | 603448 |
UniProt ID | O75553 |
◆ Recombinant Proteins | ||
DAB1-2314H | Recombinant Human DAB1 Protein, GST-tagged | +Inquiry |
DAB1-2191M | Recombinant Mouse DAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dab1-2445M | Recombinant Mouse Dab1 Protein, Myc/DDK-tagged | +Inquiry |
Dab1-400R | Recombinant Rat Dab1 Protein, His-tagged | +Inquiry |
DAB1-1425R | Recombinant Rat DAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAB1-7087HCL | Recombinant Human DAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAB1 Products
Required fields are marked with *
My Review for All DAB1 Products
Required fields are marked with *
0
Inquiry Basket