Recombinant Human DAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DAB1-2325H |
Product Overview : | DAB1 MS Standard C13 and N15-labeled recombinant protein (NP_066566) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. |
Molecular Mass : | 59.8 kDa |
AA Sequence : | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DAB1 DAB adaptor protein 1 [ Homo sapiens (human) ] |
Official Symbol | DAB1 |
Synonyms | DAB1; disabled homolog 1 (Drosophila); disabled (Drosophila) homolog 1; disabled homolog 1; |
Gene ID | 1600 |
mRNA Refseq | NM_021080 |
Protein Refseq | NP_066566 |
MIM | 603448 |
UniProt ID | O75553 |
◆ Recombinant Proteins | ||
DAB1-1425R | Recombinant Rat DAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAB1-193C | Recombinant Cynomolgus Monkey DAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAB1-2519HF | Recombinant Full Length Human DAB1 Protein, GST-tagged | +Inquiry |
Dab1-2445M | Recombinant Mouse Dab1 Protein, Myc/DDK-tagged | +Inquiry |
Dab1-400R | Recombinant Rat Dab1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAB1-7087HCL | Recombinant Human DAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAB1 Products
Required fields are marked with *
My Review for All DAB1 Products
Required fields are marked with *
0
Inquiry Basket