Recombinant Human DAB1 Protein, GST-tagged
| Cat.No. : | DAB1-2314H | 
| Product Overview : | Human DAB1 full-length ORF ( AAH67445.1, 1 a.a. - 553 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. [provided by RefSeq, Jan 2017] | 
| Molecular Mass : | 86 kDa | 
| AA Sequence : | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DAB1 disabled homolog 1 (Drosophila) [ Homo sapiens ] | 
| Official Symbol | DAB1 | 
| Synonyms | DAB1; disabled homolog 1 (Drosophila); disabled (Drosophila) homolog 1; disabled homolog 1; | 
| Gene ID | 1600 | 
| mRNA Refseq | NM_021080 | 
| Protein Refseq | NP_066566 | 
| MIM | 603448 | 
| UniProt ID | O75553 | 
| ◆ Recombinant Proteins | ||
| DAB1-4643H | Recombinant Human DAB1 protein, His-tagged | +Inquiry | 
| DAB1-4286M | Recombinant Mouse DAB1 Protein | +Inquiry | 
| Dab1-2445M | Recombinant Mouse Dab1 Protein, Myc/DDK-tagged | +Inquiry | 
| DAB1-2314H | Recombinant Human DAB1 Protein, GST-tagged | +Inquiry | 
| DAB1-2519HF | Recombinant Full Length Human DAB1 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DAB1-7087HCL | Recombinant Human DAB1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAB1 Products
Required fields are marked with *
My Review for All DAB1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            