Recombinant Human DACH1 protein, His-tagged
| Cat.No. : | DACH1-11H |
| Product Overview : | Recombinant Human DACH1 protein(Q9UI36)(611-740 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 611-740 aa |
| Form : | Phosphate buffered saline |
| AASequence : | FPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTD |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.2-1.0 mg/mL. |
| Gene Name | DACH1 dachshund homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DACH1 |
| Synonyms | DACH1; dachshund homolog 1 (Drosophila); DACH, dachshund homolog (Drosophila); dachshund homolog 1; DACH; FLJ10138; |
| Gene ID | 1602 |
| mRNA Refseq | NM_004392 |
| Protein Refseq | NP_004383 |
| MIM | 603803 |
| UniProt ID | Q9UI36 |
| ◆ Recombinant Proteins | ||
| DACH1-2311HF | Recombinant Full Length Human DACH1 Protein, GST-tagged | +Inquiry |
| DACH1-27091TH | Recombinant Human DACH1 | +Inquiry |
| DACH1-2319H | Recombinant Human DACH1 Protein, GST-tagged | +Inquiry |
| DACH1-4312C | Recombinant Chicken DACH1 | +Inquiry |
| DACH1-12H | Recombinant Human P2RY12 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DACH1-7085HCL | Recombinant Human DACH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DACH1 Products
Required fields are marked with *
My Review for All DACH1 Products
Required fields are marked with *
