Recombinant Human DAD1

Cat.No. : DAD1-27092TH
Product Overview : Recombinant full length Human DAD1 with N terminal proprietary tag, 38.17 kDa.
Availability February 06, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 113 amino acids
Description : DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line.The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis.DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
Molecular Weight : 38.170kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGAL QFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQ NKADFQGISPERAFADFLFASTILHLVVMNFVG
Sequence Similarities : Belongs to the DAD/OST2 family.
Gene Name DAD1 defender against cell death 1 [ Homo sapiens ]
Official Symbol DAD1
Synonyms DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2;
Gene ID 1603
mRNA Refseq NM_001344
Protein Refseq NP_001335
MIM 600243
Uniprot ID P61803
Chromosome Location 14q11.2
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem;
Function contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity; contributes_to oligosaccharyl transferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAD1 Products

Required fields are marked with *

My Review for All DAD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon