Recombinant Human DALRD3 protein, His-tagged
| Cat.No. : | DALRD3-2535H |
| Product Overview : | Recombinant Human DALRD3 protein(1-349 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-349 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MATRRLGVGETLGALNAALGPGGPVWIKETRTRHLRSRDFLAPHRALQARFDDGQVPEHLLHALACLQGPGVAPVLRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPASLGQRVLLHCPALRSSPCALRLSQLRTVLVADHLARALRAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSHALEELTSANDGRTLSPGILGRLCLKELVEEQGRTAGYDPNLDNCLVTEDLLSVLAELQEALWHWPEDSHPGLAGASDTGTGGCLVVHVVSCEEEFQQQKLDLLWQKLVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFRHTQVCKASALKHG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DALRD3 DALR anticodon binding domain containing 3 [ Homo sapiens ] |
| Official Symbol | DALRD3 |
| Synonyms | DALRD3; DALR anticodon binding domain containing 3; DALR anticodon-binding domain-containing protein 3; FLJ10496; |
| Gene ID | 55152 |
| mRNA Refseq | NM_001009996 |
| Protein Refseq | NP_001009996 |
| UniProt ID | Q5D0E6 |
| ◆ Recombinant Proteins | ||
| DALRD3-2337HF | Recombinant Full Length Human DALRD3 Protein, GST-tagged | +Inquiry |
| DALRD3-2535H | Recombinant Human DALRD3 protein, His-tagged | +Inquiry |
| DALRD3-6696Z | Recombinant Zebrafish DALRD3 | +Inquiry |
| DALRD3-1772R | Recombinant Rat DALRD3 Protein | +Inquiry |
| DALRD3-2197M | Recombinant Mouse DALRD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DALRD3-7081HCL | Recombinant Human DALRD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DALRD3 Products
Required fields are marked with *
My Review for All DALRD3 Products
Required fields are marked with *
