Recombinant Human DAND5 Protein, GST-tagged
Cat.No. : | DAND5-2329H |
Product Overview : | Human DAND5 partial ORF ( NP_689867, 90 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAND5 DAN domain BMP antagonist family member 5 [ Homo sapiens (human) ] |
Official Symbol | DAND5 |
Synonyms | DAND5; DAN domain BMP antagonist family member 5; DAN Domain BMP Antagonist Family Member 5; Cysteine Knot Superfamily 1, BMP Antagonist 3; DAN Domain Family Member 5, BMP Antagonist; Cerberus-Like Protein 2; Gremlin-3; CKTSF1B3; Cerl-2; GREM3; CER2; SP1; DAN Domain Family, Member 5; DAN Domain Family Member 5; Cerberus-Like 2; Cerberus 2; CERL2; DANTE; CRL2; COCO; DAN domain family member 5; DAN domain family member 5, BMP antagonist; DAN domain family, member 5; cerberus 2; cerberus-like 2; cerberus-like protein 2; cerl-2; cysteine knot superfamily 1, BMP antagonist 3; gremlin-3 |
Gene ID | 199699 |
mRNA Refseq | NM_152654 |
Protein Refseq | NP_689867 |
MIM | 609068 |
UniProt ID | Q8N907 |
◆ Recombinant Proteins | ||
DAND5-4725H | Recombinant Human DAND5 protein, His-SUMO-tagged | +Inquiry |
DAND5-12218Z | Recombinant Zebrafish DAND5 | +Inquiry |
DAND5-2329H | Recombinant Human DAND5 Protein, GST-tagged | +Inquiry |
DAND5-837H | Active Recombinant Human DAND5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAND5-7080HCL | Recombinant Human DAND5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAND5 Products
Required fields are marked with *
My Review for All DAND5 Products
Required fields are marked with *