Recombinant Human DAND5 Protein, GST-tagged

Cat.No. : DAND5-2329H
Product Overview : Human DAND5 partial ORF ( NP_689867, 90 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DAND5 DAN domain BMP antagonist family member 5 [ Homo sapiens (human) ]
Official Symbol DAND5
Synonyms DAND5; DAN domain BMP antagonist family member 5; DAN Domain BMP Antagonist Family Member 5; Cysteine Knot Superfamily 1, BMP Antagonist 3; DAN Domain Family Member 5, BMP Antagonist; Cerberus-Like Protein 2; Gremlin-3; CKTSF1B3; Cerl-2; GREM3; CER2; SP1; DAN Domain Family, Member 5; DAN Domain Family Member 5; Cerberus-Like 2; Cerberus 2; CERL2; DANTE; CRL2; COCO; DAN domain family member 5; DAN domain family member 5, BMP antagonist; DAN domain family, member 5; cerberus 2; cerberus-like 2; cerberus-like protein 2; cerl-2; cysteine knot superfamily 1, BMP antagonist 3; gremlin-3
Gene ID 199699
mRNA Refseq NM_152654
Protein Refseq NP_689867
MIM 609068
UniProt ID Q8N907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAND5 Products

Required fields are marked with *

My Review for All DAND5 Products

Required fields are marked with *

0
cart-icon
0
compare icon