Recombinant Human DAOA Protein (1-153 aa), GST-tagged
| Cat.No. : | DAOA-448H |
| Product Overview : | Recombinant Human DAOA Protein (1-153 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-153 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 45.1 kDa |
| AA Sequence : | MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | DAOA D-amino acid oxidase activator [ Homo sapiens (human) ] |
| Official Symbol | DAOA |
| Synonyms | LG72; SG72; |
| Gene ID | 267012 |
| UniProt ID | P59103 |
| ◆ Recombinant Proteins | ||
| DAOA-448H | Recombinant Human DAOA Protein (1-153 aa), GST-tagged | +Inquiry |
| DAOA-367H | Recombinant Human DAOA Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DAOA-7079HCL | Recombinant Human DAOA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAOA Products
Required fields are marked with *
My Review for All DAOA Products
Required fields are marked with *




