Recombinant Human DAP
Cat.No. : | DAP-27364TH |
Product Overview : | Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 102 amino acids |
Description : | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. |
Molecular Weight : | 36.960kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK |
Gene Name | DAP death-associated protein [ Homo sapiens ] |
Official Symbol | DAP |
Synonyms | DAP; death-associated protein; death-associated protein 1; |
Gene ID | 1611 |
mRNA Refseq | NM_004394 |
Protein Refseq | NP_004385 |
MIM | 600954 |
Uniprot ID | P51397 |
Chromosome Location | 5p15.2 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | death domain binding; |
◆ Recombinant Proteins | ||
DAP-27364TH | Recombinant Human DAP | +Inquiry |
DAP-121HF | Recombinant Full Length Human DAP Protein | +Inquiry |
DAP-2332H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
DAP-1774R | Recombinant Rat DAP Protein | +Inquiry |
DAP-1432R | Recombinant Rat DAP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAP-7078HCL | Recombinant Human DAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAP Products
Required fields are marked with *
My Review for All DAP Products
Required fields are marked with *