Recombinant Human DAP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DAP-5863H
Product Overview : DAP MS Standard C13 and N15-labeled recombinant protein (NP_004385) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Mass : 11.2 kDa
AA Sequence : MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DAP death-associated protein [ Homo sapiens (human) ]
Official Symbol DAP
Synonyms DAP; death-associated protein; death-associated protein 1; DAP-1; MGC99796;
Gene ID 1611
mRNA Refseq NM_004394
Protein Refseq NP_004385
MIM 600954
UniProt ID P51397

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAP Products

Required fields are marked with *

My Review for All DAP Products

Required fields are marked with *

0
cart-icon