Recombinant Human DARS2 Protein, GST-tagged
| Cat.No. : | DARS2-2350H |
| Product Overview : | Human DARS2 full-length ORF ( NP_060592.2, 1 a.a. - 645 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. It is a mitochondrial enzyme that specifically aminoacylates aspartyl-tRNA. Mutations in this gene are associated with leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL). [provided by RefSeq, Nov 2009] |
| Molecular Mass : | 100 kDa |
| AA Sequence : | MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DARS2 aspartyl-tRNA synthetase 2, mitochondrial [ Homo sapiens ] |
| Official Symbol | DARS2 |
| Synonyms | DARS2; aspartyl-tRNA synthetase 2, mitochondrial; aspartate--tRNA ligase, mitochondrial; aspartate tRNA ligase 2; mitochondrial; FLJ10514; aspartate tRNA ligase 2, mitochondrial; aspartyl-tRNA synthetase, mitochondrial; LBSL; ASPRS; MT-ASPRS; RP3-383J4.2; |
| Gene ID | 55157 |
| mRNA Refseq | NM_018122 |
| Protein Refseq | NP_060592 |
| MIM | 610956 |
| UniProt ID | Q6PI48 |
| ◆ Recombinant Proteins | ||
| DARS2-1776R | Recombinant Rat DARS2 Protein | +Inquiry |
| Dars2-2456M | Recombinant Mouse Dars2 Protein, Myc/DDK-tagged | +Inquiry |
| DARS2-3673B | Recombinant Bovine DARS2, His-tagged | +Inquiry |
| DARS2-443HFL | Recombinant Full Length Human DARS2 Protein, C-Flag-tagged | +Inquiry |
| DARS2-2020H | Recombinant Human DARS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DARS2-7072HCL | Recombinant Human DARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DARS2 Products
Required fields are marked with *
My Review for All DARS2 Products
Required fields are marked with *
