Name: Recombinant Human DAZ3 Protein, GST-tagged
SKU: DAZ3-2355H

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. [provided by RefSeq, Jul 2008]
Molecular Mass :	31.46 kDa
AA Sequence :	YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	DAZ3 deleted in azoospermia 3 [ Homo sapiens ]
Official Symbol	DAZ3
Synonyms	DAZ3; deleted in azoospermia 3; deleted in azoospermia protein 3; pDP1679; MGC126441;
Gene ID	57054
mRNA Refseq	NM_020364
Protein Refseq	NP_065097
MIM	400027
UniProt ID	Q9NR90