Recombinant Human DAZ3 Protein, GST-tagged
| Cat.No. : | DAZ3-2355H |
| Product Overview : | Human DAZ3 partial ORF ( NP_065097, 387 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 31.46 kDa |
| AA Sequence : | YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAZ3 deleted in azoospermia 3 [ Homo sapiens ] |
| Official Symbol | DAZ3 |
| Synonyms | DAZ3; deleted in azoospermia 3; deleted in azoospermia protein 3; pDP1679; MGC126441; |
| Gene ID | 57054 |
| mRNA Refseq | NM_020364 |
| Protein Refseq | NP_065097 |
| MIM | 400027 |
| UniProt ID | Q9NR90 |
| ◆ Recombinant Proteins | ||
| DAZ3-2355H | Recombinant Human DAZ3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAZ3 Products
Required fields are marked with *
My Review for All DAZ3 Products
Required fields are marked with *
