Recombinant Human DAZ3 Protein, GST-tagged

Cat.No. : DAZ3-2355H
Product Overview : Human DAZ3 partial ORF ( NP_065097, 387 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. [provided by RefSeq, Jul 2008]
Molecular Mass : 31.46 kDa
AA Sequence : YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DAZ3 deleted in azoospermia 3 [ Homo sapiens ]
Official Symbol DAZ3
Synonyms DAZ3; deleted in azoospermia 3; deleted in azoospermia protein 3; pDP1679; MGC126441;
Gene ID 57054
mRNA Refseq NM_020364
Protein Refseq NP_065097
MIM 400027
UniProt ID Q9NR90

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAZ3 Products

Required fields are marked with *

My Review for All DAZ3 Products

Required fields are marked with *

0
cart-icon