Recombinant Human DAZAP2 Protein, GST-tagged
| Cat.No. : | DAZAP2-2359H |
| Product Overview : | Human DAZAP2 full-length ORF ( NP_055579.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
| Molecular Mass : | 43.7 kDa |
| AA Sequence : | MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAZAP2 DAZ associated protein 2 [ Homo sapiens ] |
| Official Symbol | DAZAP2 |
| Synonyms | DAZAP2; DAZ associated protein 2; |
| Gene ID | 9802 |
| mRNA Refseq | NM_001136264 |
| Protein Refseq | NP_001129736 |
| MIM | 607431 |
| UniProt ID | Q15038 |
| ◆ Recombinant Proteins | ||
| DAZAP2-1435R | Recombinant Rat DAZAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DAZAP2-4313M | Recombinant Mouse DAZAP2 Protein | +Inquiry |
| DAZAP2-2545HF | Recombinant Full Length Human DAZAP2 Protein, GST-tagged | +Inquiry |
| DAZAP2-1777R | Recombinant Rat DAZAP2 Protein | +Inquiry |
| DAZAP2-196C | Recombinant Cynomolgus Monkey DAZAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAZAP2 Products
Required fields are marked with *
My Review for All DAZAP2 Products
Required fields are marked with *
