Recombinant Human DAZL protein, His-GST&V5-Myc-tagged
Cat.No. : | DAZL-6456H |
Product Overview : | Recombinant Human DAZL protein(Q92904)(130-250aa), fused with N-terminal His and GST tag and C-terminal V5 and Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc&V5 |
Protein Length : | 130-250aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
Gene Name | DAZL deleted in azoospermia-like [ Homo sapiens ] |
Official Symbol | DAZL |
Synonyms | DAZL; deleted in azoospermia-like; DAZLA; DAZH; DAZL1; MGC26406; SPGYLA; DAZ homolog; DAZ-like autosomal; SPGY-like-autosomal; deleted in azoospermia-like 1; germline specific RNA binding protein; spermatogenesis gene on the Y-like autosomal; |
Gene ID | 1618 |
mRNA Refseq | NM_001190811 |
Protein Refseq | NP_001177740 |
MIM | 601486 |
UniProt ID | Q92904 |
◆ Recombinant Proteins | ||
DAZL-116HF | Recombinant Full Length Human DAZL Protein | +Inquiry |
DAZL-5248H | Recombinant Human DAZL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DAZL-16H | Recombinant Human DAZL protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
DAZL-2361H | Recombinant Human DAZL Protein, GST-tagged | +Inquiry |
Dazl-2460M | Recombinant Mouse Dazl Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAZL-7068HCL | Recombinant Human DAZL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAZL Products
Required fields are marked with *
My Review for All DAZL Products
Required fields are marked with *