"DBF4B" Related Products

Recombinant Human DBF4B Protein, GST-tagged

Cat.No. : DBF4B-2657H
Product Overview : Human DRF1 full-length ORF ( NP_079380.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and, in complex with the cell division cycle 7 homolog (S. cerevisiae) protein, may facilitate M phase progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 44.8 kDa
AA Sequence : MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : DBF4B DBF4 homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol : DBF4B
Synonyms : DBF4B; DBF4 homolog B (S. cerevisiae); protein DBF4 homolog B; ASKL1; chifb; chiffon homolog B (Drosophila); DRF1; FLJ13087; ZDBF1B; zinc finger; DBF type containing 1B; chiffon homolog B; ASK-like protein 1; Dbf4-related factor 1; zinc finger, DBF-type containing 1B; activator of S-phase kinase-like protein 1; CHIFB; MGC15009;
Gene ID : 80174
mRNA Refseq : NM_025104
Protein Refseq : NP_079380
MIM : 611661
UniProt ID : Q8NFT6

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.