Recombinant Full Length Human DBF4B Protein, GST-tagged
Cat.No. : | DBF4B-3930HF |
Product Overview : | Human DRF1 full-length ORF ( NP_079380.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 170 amino acids |
Description : | This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and, in complex with the cell division cycle 7 homolog (S. cerevisiae) protein, may facilitate M phase progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DBF4B DBF4 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DBF4B |
Synonyms | DBF4B; DBF4 homolog B (S. cerevisiae); protein DBF4 homolog B; ASKL1; chifb; chiffon homolog B (Drosophila); DRF1; FLJ13087; ZDBF1B; zinc finger; DBF type containing 1B; chiffon homolog B; ASK-like protein 1; Dbf4-related factor 1; zinc finger, DBF-type containing 1B; activator of S-phase kinase-like protein 1; CHIFB; MGC15009; |
Gene ID | 80174 |
mRNA Refseq | NM_025104 |
Protein Refseq | NP_079380 |
MIM | 611661 |
UniProt ID | Q8NFT6 |
◆ Recombinant Proteins | ||
DBF4B-3930HF | Recombinant Full Length Human DBF4B Protein, GST-tagged | +Inquiry |
DBF4B-689H | Recombinant Human DBF4B Protein, MYC/DDK-tagged | +Inquiry |
DBF4B-6459H | Recombinant Human DBF4B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DBF4B-2657H | Recombinant Human DBF4B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBF4B-2114HCL | Recombinant Human DBF4B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DBF4B Products
Required fields are marked with *
My Review for All DBF4B Products
Required fields are marked with *
0
Inquiry Basket