Recombinant Human DBH
Cat.No. : | DBH-26886TH |
Product Overview : | Recombinant fragment corresponding to amino acids 494-603 of Human Dopamine beta Hydroxylase with an N terminal proprietary tag: Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSF NRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVIS TLEEPTPQCPTSQGRSPAGPTVVSIGGGKG |
Sequence Similarities : | Belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 1 DOMON domain. |
Gene Name : | DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ] |
Official Symbol : | DBH |
Synonyms : | DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM; |
Gene ID : | 1621 |
mRNA Refseq : | NM_000787 |
Protein Refseq : | NP_000778 |
MIM : | 609312 |
Uniprot ID : | P09172 |
Chromosome Location : | 9q34 |
Pathway : | Amine-derived hormones, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Catecholamine biosynthesis, organism-specific biosystem; Catecholamine biosynthesis, tyrosine => dopamine => |
Function : | L-ascorbic acid binding; catalytic activity; copper ion binding; dopamine beta-monooxygenase activity; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
DBH-2122H | Recombinant Human DBH Protein, His-tagged | +Inquiry |
DBH-210H | Recombinant Human DBH protein(Ser26-Gly603), His-tagged | +Inquiry |
DBH-719H | Recombinant Human DBH Protein, His (Fc)-Avi-tagged | +Inquiry |
DBH-2366H | Recombinant Human DBH Protein, GST-tagged | +Inquiry |
DBH-983H | Recombinant Human DBH Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
DBH-869HCL | Recombinant Human DBH cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket