Recombinant Human DBH
Cat.No. : | DBH-26886TH |
Product Overview : | Recombinant fragment corresponding to amino acids 494-603 of Human Dopamine beta Hydroxylase with an N terminal proprietary tag: Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSF NRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVIS TLEEPTPQCPTSQGRSPAGPTVVSIGGGKG |
Sequence Similarities : | Belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 1 DOMON domain. |
Gene Name | DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ] |
Official Symbol | DBH |
Synonyms | DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM; |
Gene ID | 1621 |
mRNA Refseq | NM_000787 |
Protein Refseq | NP_000778 |
MIM | 609312 |
Uniprot ID | P09172 |
Chromosome Location | 9q34 |
Pathway | Amine-derived hormones, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Catecholamine biosynthesis, organism-specific biosystem; Catecholamine biosynthesis, tyrosine => dopamine => |
Function | L-ascorbic acid binding; catalytic activity; copper ion binding; dopamine beta-monooxygenase activity; metal ion binding; |
◆ Recombinant Proteins | ||
DBH-2366H | Recombinant Human DBH Protein, GST-tagged | +Inquiry |
DBH-2611H | Recombinant Human DBH protein(41-270 aa), N-MBP & N-His-tagged | +Inquiry |
Dbh-2461M | Recombinant Mouse Dbh Protein, Myc/DDK-tagged | +Inquiry |
DBH-1923H | Recombinant Human DBH Protein (His335-Val571), N-His tagged | +Inquiry |
DBH-11841H | Recombinant Human DBH, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBH-869HCL | Recombinant Human DBH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBH Products
Required fields are marked with *
My Review for All DBH Products
Required fields are marked with *