Recombinant Human DBH

• Cat.No.: DBH-26886TH
• Product Overview: Recombinant fragment corresponding to amino acids 494-603 of Human Dopamine beta Hydroxylase with an N terminal proprietary tag: Predicted MWt 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSF NRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVIS TLEEPTPQCPTSQGRSPAGPTVVSIGGGKG
• Sequence Similarities: Belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 1 DOMON domain.

Gene Information

• Gene Name: DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ]
• Official Symbol: DBH
• Synonyms: DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM
• Gene ID: 1621
• mRNA Refseq: NM_000787
• Protein Refseq: NP_000778
• MIM: 609312
• Uniprot ID: P09172
• Chromosome Location: 9q34
• Pathway: Amine-derived hormones, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Catecholamine biosynthesis, organism-specific biosystem; Catecholamine biosynthesis, tyrosine => dopamine =>
• Function: L-ascorbic acid binding; catalytic activity; copper ion binding; dopamine beta-monooxygenase activity; metal ion binding