Recombinant Human DBH

Cat.No. : DBH-26886TH
Product Overview : Recombinant fragment corresponding to amino acids 494-603 of Human Dopamine beta Hydroxylase with an N terminal proprietary tag: Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSF NRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVIS TLEEPTPQCPTSQGRSPAGPTVVSIGGGKG
Sequence Similarities : Belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 1 DOMON domain.
Gene Name DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ]
Official Symbol DBH
Synonyms DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM;
Gene ID 1621
mRNA Refseq NM_000787
Protein Refseq NP_000778
MIM 609312
Uniprot ID P09172
Chromosome Location 9q34
Pathway Amine-derived hormones, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Catecholamine biosynthesis, organism-specific biosystem; Catecholamine biosynthesis, tyrosine => dopamine =>
Function L-ascorbic acid binding; catalytic activity; copper ion binding; dopamine beta-monooxygenase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DBH Products

Required fields are marked with *

My Review for All DBH Products

Required fields are marked with *

0
cart-icon
0
compare icon