Recombinant Human DBH Protein, GST-tagged

Cat.No. : DBH-2366H
Product Overview : Human DBH partial ORF ( AAH17174, 494 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.95 kDa
AA Sequence : DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ]
Official Symbol DBH
Synonyms DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM;
Gene ID 1621
mRNA Refseq NM_000787
Protein Refseq NP_000778
MIM 609312
UniProt ID P09172

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DBH Products

Required fields are marked with *

My Review for All DBH Products

Required fields are marked with *

0
cart-icon
0
compare icon