Recombinant Human DBH Protein, GST-tagged
Cat.No. : | DBH-2366H |
Product Overview : | Human DBH partial ORF ( AAH17174, 494 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.95 kDa |
AA Sequence : | DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DBH dopamine beta-hydroxylase (dopamine beta-monooxygenase) [ Homo sapiens ] |
Official Symbol | DBH |
Synonyms | DBH; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; DBM; |
Gene ID | 1621 |
mRNA Refseq | NM_000787 |
Protein Refseq | NP_000778 |
MIM | 609312 |
UniProt ID | P09172 |
◆ Recombinant Proteins | ||
DBH-983H | Recombinant Human DBH Protein, MYC/DDK-tagged | +Inquiry |
DBH-4346H | Recombinant Human DBH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DBH-210H | Recombinant Human DBH protein(Ser26-Gly603), His-tagged | +Inquiry |
DBH-929H | Recombinant Human DBH | +Inquiry |
DBH-2122H | Recombinant Human DBH Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBH-869HCL | Recombinant Human DBH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBH Products
Required fields are marked with *
My Review for All DBH Products
Required fields are marked with *