Recombinant Human DBT protein, His-tagged
Cat.No. : | DBT-10H |
Product Overview : | Recombinant Human DBT protein(P11182, 71-330 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-330 aa |
Form : | 0.15 M Phosphate buffered saline |
AA Sequence : | DIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVD |
Storage : | Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | DBT dihydrolipoamide branched chain transacylase E2 [ Homo sapiens ] |
Official Symbol | DBT |
Synonyms | DBT; dihydrolipoamide branched chain transacylase E2; dihydrolipoamide branched chain transacylase (E2 component of branched chain keto acid dehydrogenase complex; maple syrup urine disease); lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; BCKADE2; BCKAD-E2; BCKAD E2 subunit; dihydrolipoyl transacylase; branched chain acyltransferase, E2 component; dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; branched-chain alpha-keto acid dehydrogenase complex component E2; E2 component of branched chain alpha-keto acid dehydrogenase complex; mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit (E2b); dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; lipoamide acyltransferase component of mitochondrial branched-chain alpha-keto acid dehydrogenase complex; E2; E2B; BCATE2; MGC9061; |
Gene ID | 1629 |
mRNA Refseq | NM_001918 |
Protein Refseq | NP_001909 |
MIM | 248610 |
UniProt ID | P11182 |
◆ Recombinant Proteins | ||
DBT-1007R | Recombinant Rhesus Macaque DBT Protein, His (Fc)-Avi-tagged | +Inquiry |
DBT-2183Z | Recombinant Zebrafish DBT | +Inquiry |
DBT-7061H | Recombinant Human DBT protein, MYC/DDK-tagged | +Inquiry |
DBT-7658HFL | Recombinant Full Length Human DBT protein, Flag-tagged | +Inquiry |
DBT-2712HF | Recombinant Full Length Human DBT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBT-7061HCL | Recombinant Human DBT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DBT Products
Required fields are marked with *
My Review for All DBT Products
Required fields are marked with *
0
Inquiry Basket