Recombinant Human DBX1 Protein, GST-tagged
Cat.No. : | DBX1-2377H |
Product Overview : | Human DBX1 full-length ORF ( AAI56155.1, 1 a.a. - 382 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DBX1 (Developing Brain Homeobox 1) is a Protein Coding gene. Diseases associated with DBX1 include Central Hypoventilation Syndrome, Congenital. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is DBX2. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPTASMSPPRQGAPTALTDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGPRTETSPALLQSVPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQDTARRTEPAPDSTPRPRASPGAPDLTSASPFFSPAGTFQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DBX1 developing brain homeobox 1 [ Homo sapiens ] |
Official Symbol | DBX1 |
Synonyms | DBX1; developing brain homeobox 1; homeobox protein DBX1; developing brain homeobox protein 1; |
Gene ID | 120237 |
mRNA Refseq | NM_001029865 |
Protein Refseq | NP_001025036 |
UniProt ID | A6NMT0 |
◆ Recombinant Proteins | ||
DBX1-1785R | Recombinant Rat DBX1 Protein | +Inquiry |
DBX1-4327M | Recombinant Mouse DBX1 Protein | +Inquiry |
DBX1-4330C | Recombinant Chicken DBX1 | +Inquiry |
DBX1-2713HF | Recombinant Full Length Human DBX1 Protein, GST-tagged | +Inquiry |
DBX1-1443R | Recombinant Rat DBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBX1 Products
Required fields are marked with *
My Review for All DBX1 Products
Required fields are marked with *