Recombinant Human DCAF8 protein, GST-tagged
Cat.No. : | DCAF8-5633H |
Product Overview : | Recombinant Human DCAF8 protein(311-594 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 311-594 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | IDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVGGRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSDGAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHLPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRRWREPGVGATDADSDESPSSSDTSDEEEGPDRVQC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DCAF8 DDB1 and CUL4 associated factor 8 [ Homo sapiens ] |
Official Symbol | DCAF8 |
Synonyms | DCAF8; DDB1 and CUL4 associated factor 8; WD repeat domain 42A , WDR42A; DDB1- and CUL4-associated factor 8; FLJ35857; H326; WD repeat domain 42A; WD repeat-containing protein 42A; WDR42A; MGC99640; MGC117276; MGC118891; DKFZp781G1096; |
Gene ID | 50717 |
mRNA Refseq | NM_015726 |
Protein Refseq | NP_056541 |
UniProt ID | Q5TAQ9 |
◆ Recombinant Proteins | ||
DCAF8-5633H | Recombinant Human DCAF8 protein, GST-tagged | +Inquiry |
DCAF8-4340M | Recombinant Mouse DCAF8 Protein | +Inquiry |
DCAF8-1446R | Recombinant Rat DCAF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCAF8-1788R | Recombinant Rat DCAF8 Protein | +Inquiry |
DCAF8-6437H | Recombinant Human DCAF8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAF8-7054HCL | Recombinant Human DCAF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCAF8 Products
Required fields are marked with *
My Review for All DCAF8 Products
Required fields are marked with *