Recombinant Human DCC protein(1131-1200 aa), C-His-tagged

Cat.No. : DCC-2762H
Product Overview : Recombinant Human DCC protein(P43146)(1131-1200 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1131-1200 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
Gene Name DCC deleted in colorectal carcinoma [ Homo sapiens ]
Official Symbol DCC
Synonyms DCC; deleted in colorectal carcinoma; netrin receptor DCC; IGDCC1; immunoglobulin superfamily; DCC subclass; member 1; colorectal tumor suppressor; colorectal cancer suppressor; tumor suppressor protein DCC; deleted in colorectal cancer protein; immunoglobulin superfamily DCC subclass member 1; immunoglobulin superfamily, DCC subclass, member 1; CRC18; CRCR1;
Gene ID 1630
mRNA Refseq NM_005215
Protein Refseq NP_005206
MIM 120470
UniProt ID P43146

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCC Products

Required fields are marked with *

My Review for All DCC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon