Recombinant Human DCC protein(1131-1200 aa), C-His-tagged

• Cat.No.: DCC-2762H
• Product Overview: Recombinant Human DCC protein(P43146)(1131-1200 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1131-1200 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS

Gene Information

• Gene Name: DCC deleted in colorectal carcinoma [ Homo sapiens ]
• Official Symbol: DCC
• Synonyms: DCC; deleted in colorectal carcinoma; netrin receptor DCC; IGDCC1; immunoglobulin superfamily; DCC subclass; member 1; colorectal tumor suppressor; colorectal cancer suppressor; tumor suppressor protein DCC; deleted in colorectal cancer protein; immunoglobulin superfamily DCC subclass member 1; immunoglobulin superfamily, DCC subclass, member 1; CRC18; CRCR1
• Gene ID: 1630
• mRNA Refseq: NM_005215
• Protein Refseq: NP_005206
• MIM: 120470
• UniProt ID: P43146