Recombinant Human DCC protein(1131-1200 aa), C-His-tagged
| Cat.No. : | DCC-2762H |
| Product Overview : | Recombinant Human DCC protein(P43146)(1131-1200 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1131-1200 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS |
| Gene Name | DCC deleted in colorectal carcinoma [ Homo sapiens ] |
| Official Symbol | DCC |
| Synonyms | DCC; deleted in colorectal carcinoma; netrin receptor DCC; IGDCC1; immunoglobulin superfamily; DCC subclass; member 1; colorectal tumor suppressor; colorectal cancer suppressor; tumor suppressor protein DCC; deleted in colorectal cancer protein; immunoglobulin superfamily DCC subclass member 1; immunoglobulin superfamily, DCC subclass, member 1; CRC18; CRCR1; |
| Gene ID | 1630 |
| mRNA Refseq | NM_005215 |
| Protein Refseq | NP_005206 |
| MIM | 120470 |
| UniProt ID | P43146 |
| ◆ Recombinant Proteins | ||
| DCC-4344M | Recombinant Mouse DCC Protein | +Inquiry |
| DCC-2227M | Recombinant Mouse DCC Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dcc-2470M | Recombinant Mouse Dcc Protein, Myc/DDK-tagged | +Inquiry |
| DCC-2118H | Active Recombinant Human DCC protein, His-tagged | +Inquiry |
| DCC-1171H | Recombinant Human DCC Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCC Products
Required fields are marked with *
My Review for All DCC Products
Required fields are marked with *



