Recombinant Human DCD Protein (20-110 aa), His-tagged

• Cat.No.: DCD-1376H
• Product Overview: Recombinant Human DCD Protein (20-110 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 20-110 aa
• Description: DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resble the conditions in sweat. Also exhibits proteolytic activity.Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.3 kDa
• AA Sequence: YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: DCD dermcidin [ Homo sapiens ]
• Official Symbol: DCD
• Synonyms: DCD; dermcidin; AIDD; DCD 1; DSEP; HCAP; PIF; DCD-1; MGC71930
• Gene ID: 117159
• mRNA Refseq: NM_053283
• Protein Refseq: NP_444513
• MIM: 606634
• UniProt ID: P81605