Recombinant Human DCDC2 protein, GST-tagged
Cat.No. : | DCDC2-301165H |
Product Overview : | Recombinant Human DCDC2 (351-476 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu351-Ala476 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DCDC2 doublecortin domain containing 2 [ Homo sapiens ] |
Official Symbol | DCDC2 |
Synonyms | DCDC2; doublecortin domain containing 2; doublecortin domain-containing protein 2; DCDC2A; KIAA1154; RU2; RU2S; |
Gene ID | 51473 |
mRNA Refseq | NM_001195610 |
Protein Refseq | NP_001182539 |
MIM | 605755 |
UniProt ID | Q9UHG0 |
◆ Recombinant Proteins | ||
DCDC2-301165H | Recombinant Human DCDC2 protein, GST-tagged | +Inquiry |
DCDC2-2389H | Recombinant Human DCDC2 Protein, GST-tagged | +Inquiry |
DCDC2-1450R | Recombinant Rat DCDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCDC2-3063H | Recombinant Human DCDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DCDC2-1792R | Recombinant Rat DCDC2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCDC2-7052HCL | Recombinant Human DCDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCDC2 Products
Required fields are marked with *
My Review for All DCDC2 Products
Required fields are marked with *