Recombinant Human DCK Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DCK-734H |
Product Overview : | DCK MS Standard C13 and N15-labeled recombinant protein (NP_000779) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | MATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DCK deoxycytidine kinase [ Homo sapiens (human) ] |
Official Symbol | DCK |
Synonyms | DCK; deoxycytidine kinase; deoxynucleoside kinase; MGC117410; MGC138632; |
Gene ID | 1633 |
mRNA Refseq | NM_000788 |
Protein Refseq | NP_000779 |
MIM | 125450 |
UniProt ID | P27707 |
◆ Recombinant Proteins | ||
DCK-06HFL | Active Recombinant Full Length Human deoxycytidine kinase Protein, His tagged | +Inquiry |
DCK-11853H | Recombinant Human DCK, GST-tagged | +Inquiry |
DCK-2390H | Recombinant Human DCK Protein, GST-tagged | +Inquiry |
DCK-1626Z | Recombinant Zebrafish DCK | +Inquiry |
Dck-2472M | Recombinant Mouse Dck Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
DCK-07HFL | Active Recombinant Full Length Human deoxycytidine kinase Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCK-7051HCL | Recombinant Human DCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCK Products
Required fields are marked with *
My Review for All DCK Products
Required fields are marked with *