Recombinant Human DCLK1 protein, His-tagged
| Cat.No. : | DCLK1-0399H |
| Product Overview : | Recombinant Human DCLK1 protein(623-729 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 623-729 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DCLK1 doublecortin-like kinase 1 [ Homo sapiens ] |
| Official Symbol | DCLK1 |
| Synonyms | DCLK1; doublecortin-like kinase 1; DCAMKL1, doublecortin and CaM kinase like 1; serine/threonine-protein kinase DCLK1; DCDC3A; DCLK; KIAA0369; doublecortin and CaM kinase-like 1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A; CL1; CLICK1; DCAMKL1; |
| Gene ID | 9201 |
| mRNA Refseq | NM_001195415 |
| Protein Refseq | NP_001182344 |
| MIM | 604742 |
| UniProt ID | O15075 |
| ◆ Recombinant Proteins | ||
| DCLK1-4602C | Recombinant Chicken DCLK1 | +Inquiry |
| DCLK1-1169H | Recombinant Human DCLK1 Protein, MYC/DDK-tagged | +Inquiry |
| DCLK1-519H | Recombinant Human DCLK1, Gly & Pro tagged | +Inquiry |
| DCLK1-63HFL | Active Recombinant Full Length Human DCLK1 Protein, N-His-tagged | +Inquiry |
| DCLK1-7843H | Recombinant Human DCLK1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCLK1-435HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
| DCLK1-001HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCLK1 Products
Required fields are marked with *
My Review for All DCLK1 Products
Required fields are marked with *
