Recombinant Human DCLK1 protein, His-tagged
Cat.No. : | DCLK1-0399H |
Product Overview : | Recombinant Human DCLK1 protein(623-729 aa), fused to His tag, was expressed in E. coli. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 623-729 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DCLK1 doublecortin-like kinase 1 [ Homo sapiens ] |
Official Symbol | DCLK1 |
Synonyms | DCLK1; doublecortin-like kinase 1; DCAMKL1, doublecortin and CaM kinase like 1; serine/threonine-protein kinase DCLK1; DCDC3A; DCLK; KIAA0369; doublecortin and CaM kinase-like 1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A; CL1; CLICK1; DCAMKL1; |
Gene ID | 9201 |
mRNA Refseq | NM_001195415 |
Protein Refseq | NP_001182344 |
MIM | 604742 |
UniProt ID | O15075 |
◆ Recombinant Proteins | ||
DCLK1-0863H | Recombinant Human DCLK1 Protein (S2-F740), GST tagged | +Inquiry |
DCLK1-2392H | Active Recombinant Human DCLK1 Protein, GST-tagged | +Inquiry |
DCLK1-2383H | Recombinant Human DCLK1 Protein, GST-tagged | +Inquiry |
DCLK1-211H | Recombinant Human DCLK1 Protein, His-tagged | +Inquiry |
DCLK1-519H | Recombinant Human DCLK1, Gly & Pro tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCLK1-435HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
DCLK1-001HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCLK1 Products
Required fields are marked with *
My Review for All DCLK1 Products
Required fields are marked with *