Recombinant Human DCLK3 Protein, GST-tagged

Cat.No. : DCLK3-2384H
Product Overview : Human DCAMKL3 partial ORF ( XP_047355, 1031 a.a. - 1140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DCLK3 (Doublecortin Like Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is DCLK1.
Molecular Mass : 37.84 kDa
AA Sequence : EKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCLK3 doublecortin-like kinase 3 [ Homo sapiens ]
Official Symbol DCLK3
Synonyms DCLK3; doublecortin-like kinase 3; DCAMKL3, doublecortin and CaM kinase like 3; serine/threonine-protein kinase DCLK3; DCDC3C; KIAA1765; CLICK-I,II-related; doublecortin and CaM kinase-like 3; doublecortin-like and CAM kinase-like 3; doublecortin domain-containing protein 3C; CLR; DCK3; DCAMKL3;
Gene ID 85443
mRNA Refseq NM_033403
Protein Refseq NP_208382
MIM 613167
UniProt ID Q9C098

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCLK3 Products

Required fields are marked with *

My Review for All DCLK3 Products

Required fields are marked with *

0
cart-icon