Recombinant Human DCLK3 Protein, GST-tagged
| Cat.No. : | DCLK3-2384H |
| Product Overview : | Human DCAMKL3 partial ORF ( XP_047355, 1031 a.a. - 1140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DCLK3 (Doublecortin Like Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is DCLK1. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | EKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCLK3 doublecortin-like kinase 3 [ Homo sapiens ] |
| Official Symbol | DCLK3 |
| Synonyms | DCLK3; doublecortin-like kinase 3; DCAMKL3, doublecortin and CaM kinase like 3; serine/threonine-protein kinase DCLK3; DCDC3C; KIAA1765; CLICK-I,II-related; doublecortin and CaM kinase-like 3; doublecortin-like and CAM kinase-like 3; doublecortin domain-containing protein 3C; CLR; DCK3; DCAMKL3; |
| Gene ID | 85443 |
| mRNA Refseq | NM_033403 |
| Protein Refseq | NP_208382 |
| MIM | 613167 |
| UniProt ID | Q9C098 |
| ◆ Recombinant Proteins | ||
| DCLK3-2252H | Recombinant Human DCLK3 Protein (Met1-Ser648), N-His tagged | +Inquiry |
| DCLK3-4352M | Recombinant Mouse DCLK3 Protein | +Inquiry |
| DCLK3-2384H | Recombinant Human DCLK3 Protein, GST-tagged | +Inquiry |
| DCLK3-1320H | Recombinant Human DCLK3 Protein, His&GST-tagged | +Inquiry |
| Dclk3-1321M | Recombinant Mouse Dclk3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCLK3 Products
Required fields are marked with *
My Review for All DCLK3 Products
Required fields are marked with *
