Recombinant Human DCLK3 Protein, GST-tagged

• Cat.No.: DCLK3-2384H
• Product Overview: Human DCAMKL3 partial ORF ( XP_047355, 1031 a.a. - 1140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DCLK3 (Doublecortin Like Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is DCLK1.
• Molecular Mass: 37.84 kDa
• AA Sequence: EKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCLK3 doublecortin-like kinase 3 [ Homo sapiens ]
• Official Symbol: DCLK3
• Synonyms: DCLK3; doublecortin-like kinase 3; DCAMKL3, doublecortin and CaM kinase like 3; serine/threonine-protein kinase DCLK3; DCDC3C; KIAA1765; CLICK-I,II-related; doublecortin and CaM kinase-like 3; doublecortin-like and CAM kinase-like 3; doublecortin domain-containing protein 3C; CLR; DCK3; DCAMKL3
• Gene ID: 85443
• mRNA Refseq: NM_033403
• Protein Refseq: NP_208382
• MIM: 613167
• UniProt ID: Q9C098