Recombinant Human DCN protein(17-359 aa), N-SUMO & C-His-tagged

• Cat.No.: DCN-2586H
• Product Overview: Recombinant Human DCN protein(P07585)(17-359 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 17-359 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Gene Information

• Gene Name: DCN decorin [ Homo sapiens ]
• Official Symbol: DCN
• Synonyms: DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2
• Gene ID: 1634
• mRNA Refseq: NM_001920
• Protein Refseq: NP_001911
• MIM: 125255
• UniProt ID: P07585