Recombinant Human DCN protein(17-359 aa), N-SUMO & C-His-tagged
Cat.No. : | DCN-2586H |
Product Overview : | Recombinant Human DCN protein(P07585)(17-359 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 17-359 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |
Gene Name | DCN decorin [ Homo sapiens ] |
Official Symbol | DCN |
Synonyms | DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2; |
Gene ID | 1634 |
mRNA Refseq | NM_001920 |
Protein Refseq | NP_001911 |
MIM | 125255 |
UniProt ID | P07585 |
◆ Recombinant Proteins | ||
DCN-5390B | Recombinant Bovine DCN protein, His-tagged | +Inquiry |
DCN-1930H | Recombinant Human DCN protein(Met1-Lys359), His-tagged | +Inquiry |
DCN-1797R | Recombinant Rat DCN Protein | +Inquiry |
Dcn-64M | Recombinant Mouse Dcn protein, His-tagged | +Inquiry |
DCN-1600H | Recombinant Human Decorin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *
0
Inquiry Basket