Recombinant Human DCN protein, His-tagged
Cat.No. : | DCN-2804H |
Product Overview : | Recombinant Human DCN protein(P07585)(20-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-359aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DCN decorin [ Homo sapiens ] |
Official Symbol | DCN |
Synonyms | DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2; |
Gene ID | 1634 |
mRNA Refseq | NM_001920 |
Protein Refseq | NP_001911 |
MIM | 125255 |
UniProt ID | P07585 |
◆ Recombinant Proteins | ||
DCN-1702H | Active Recombinant Human Decorin, HIgG1 Fc-tagged | +Inquiry |
DCN-2398H | Recombinant Human DCN Protein, GST-tagged | +Inquiry |
DCN-3358H | Recombinant Human DCN protein, His-tagged | +Inquiry |
DCN-311H | Recombinant Human DCN Protein, His-tagged | +Inquiry |
Dcn-2805M | Recombinant Mouse Dcn protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *