Recombinant Human DCN protein, His-tagged
| Cat.No. : | DCN-2804H |
| Product Overview : | Recombinant Human DCN protein(P07585)(20-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-359aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DCN decorin [ Homo sapiens ] |
| Official Symbol | DCN |
| Synonyms | DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2; |
| Gene ID | 1634 |
| mRNA Refseq | NM_001920 |
| Protein Refseq | NP_001911 |
| MIM | 125255 |
| UniProt ID | P07585 |
| ◆ Recombinant Proteins | ||
| DCN-4355M | Recombinant Mouse DCN protein, His-tagged | +Inquiry |
| DCN-2804H | Recombinant Human DCN protein, His-tagged | +Inquiry |
| DCN-5390B | Recombinant Bovine DCN protein, His-tagged | +Inquiry |
| DCN-73H | Recombinant Human DCN protein(Asp31-Lys359), hFc-tagged | +Inquiry |
| DCN-2586H | Recombinant Human DCN protein(17-359 aa), N-SUMO & C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *
