Recombinant Human DCP1A Protein, His-tagged
Cat.No. : | DCP1A-291H |
Product Overview : | Recombinant Human DCP1A Protien(NP_060873)(1-350 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | DCP1A DCP1 decapping enzyme homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCP1A |
Synonyms | DCP1A; DCP1 decapping enzyme homolog A (S. cerevisiae); mRNA-decapping enzyme 1A; HSA275986; SMAD4IP1; SMIF; decapping enzyme hDcp1a; transcription factor SMIF; putative protein product of Nbla00360; Smad4-interacting transcriptional co-activator; Nbla00360; FLJ21691; |
Gene ID | 55802 |
mRNA Refseq | NM_018403 |
Protein Refseq | NP_060873 |
MIM | 607010 |
UniProt ID | Q9NPI6 |
◆ Recombinant Proteins | ||
DCP1A-6648H | Recombinant Human DCP1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DCP1A-2399H | Recombinant Human DCP1A Protein, GST-tagged | +Inquiry |
DCP1A-4904H | Recombinant Human DCP1A protein, His-tagged | +Inquiry |
DCP1A-726H | Recombinant Human DCP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
DCP1A-4356M | Recombinant Mouse DCP1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCP1A-7048HCL | Recombinant Human DCP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCP1A Products
Required fields are marked with *
My Review for All DCP1A Products
Required fields are marked with *