Recombinant Human DCPS protein(7-160 aa), His-tagged

Cat.No. : DCPS-11864H
Product Overview : Recombinant Human DCPS protein(7-160 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 7-160 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name DCPS decapping enzyme, scavenger [ Homo sapiens ]
Official Symbol DCPS
Synonyms DCPS; HSL1; HINT-5; HSPC015; decapping enzyme, scavenger ; scavenger mRNA-decapping enzyme DcpS; DCS-1; OTTHUMP00000231113; mRNA decapping enzyme; heat shock-like protein 1;histidine triad protein member 5; hint-related 7meGMP-directed hydrolase; homolog of C. elegans 7meGMP-directed hydrolase dcs-1; EC 3
Gene ID 28960
mRNA Refseq NM_014026
Protein Refseq NP_054745
MIM 610534
UniProt ID Q96C86

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCPS Products

Required fields are marked with *

My Review for All DCPS Products

Required fields are marked with *

0
cart-icon
0
compare icon