Recombinant Human DCT protein, His-tagged
Cat.No. : | DCT-11864H |
Product Overview : | Recombinant Human DCT protein(1-350 aa), fused with His tag, was expressed in E.coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DCT dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) [ Homo sapiens ] |
Official Symbol | DCT |
Synonyms | DCT; dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2); TYRP2; L-dopachrome tautomerase; DT; TRP2; dopachrome delta-isomerase; L-dopachrome Delta-isomerase; tyrosinase-related protein 2; TRP-2; |
Gene ID | 1638 |
mRNA Refseq | NM_001129889 |
Protein Refseq | NP_001123361 |
MIM | 191275 |
UniProt ID | P40126 |
◆ Recombinant Proteins | ||
DCT-2406H | Recombinant Human DCT Protein, GST-tagged | +Inquiry |
DCT-6495C | Recombinant Chicken DCT | +Inquiry |
DCT-11864H | Recombinant Human DCT protein, His-tagged | +Inquiry |
RFL16078MF | Recombinant Full Length Mouse L-Dopachrome Tautomerase(Dct) Protein, His-Tagged | +Inquiry |
Dct-2479M | Recombinant Mouse Dct Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCT-7045HCL | Recombinant Human DCT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCT Products
Required fields are marked with *
My Review for All DCT Products
Required fields are marked with *