Recombinant Human DCTD, His-tagged
Cat.No. : | DCTD-27366TH |
Product Overview : | Recombinant full length Human DCTD with N terminal His tag; 198 amino acids, MWt 22.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 178 amino acids |
Description : | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 22.100kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ |
Sequence Similarities : | Belongs to the cytidine and deoxycytidylate deaminase family. |
Gene Name | DCTD dCMP deaminase [ Homo sapiens ] |
Official Symbol | DCTD |
Synonyms | DCTD; dCMP deaminase; deoxycytidylate deaminase; |
Gene ID | 1635 |
mRNA Refseq | NM_001012732 |
Protein Refseq | NP_001012750 |
MIM | 607638 |
Uniprot ID | P32321 |
Chromosome Location | 4q35.1 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; |
Function | dCMP deaminase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
DCTD-1584C | Recombinant Chicken DCTD | +Inquiry |
DCTD-1457R | Recombinant Rat DCTD Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTD-27369TH | Recombinant Human DCTD, T7 -tagged | +Inquiry |
DCTD-1019R | Recombinant Rhesus Macaque DCTD Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTD-11865H | Recombinant Human DCTD, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTD-7044HCL | Recombinant Human DCTD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCTD Products
Required fields are marked with *
My Review for All DCTD Products
Required fields are marked with *