Recombinant Human DCTD, His-tagged

Cat.No. : DCTD-27366TH
Product Overview : Recombinant full length Human DCTD with N terminal His tag; 198 amino acids, MWt 22.1kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 178 amino acids
Description : The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 22.100kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
Sequence Similarities : Belongs to the cytidine and deoxycytidylate deaminase family.
Gene Name DCTD dCMP deaminase [ Homo sapiens ]
Official Symbol DCTD
Synonyms DCTD; dCMP deaminase; deoxycytidylate deaminase;
Gene ID 1635
mRNA Refseq NM_001012732
Protein Refseq NP_001012750
MIM 607638
Uniprot ID P32321
Chromosome Location 4q35.1
Pathway Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem;
Function dCMP deaminase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCTD Products

Required fields are marked with *

My Review for All DCTD Products

Required fields are marked with *

0
cart-icon