Recombinant Human DCTPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DCTPP1-3484H |
Product Overview : | DCTPP1 MS Standard C13 and N15-labeled recombinant protein (NP_077001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DCTPP1 dCTP pyrophosphatase 1 [ Homo sapiens (human) ] |
Official Symbol | DCTPP1 |
Synonyms | DCTPP1; dCTP pyrophosphatase 1; CDA03; MGC5627; RS21C6; XTP3 transactivated protein A; XTP3TPA; dCTPase 1; XTP3-transactivated protein A; deoxycytidine-triphosphatase 1; XTP3-transactivated gene A protein; |
Gene ID | 79077 |
mRNA Refseq | NM_024096 |
Protein Refseq | NP_077001 |
MIM | 615840 |
UniProt ID | Q9H773 |
◆ Recombinant Proteins | ||
DCTPP1-1381H | Recombinant Human DCTP Pyrophosphatase 1, His-tagged | +Inquiry |
DCTPP1-2243M | Recombinant Mouse DCTPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTPP1-730H | Recombinant Human DCTPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTPP1-3484H | Recombinant Human DCTPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DCTPP1-1803R | Recombinant Rat DCTPP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTPP1-7036HCL | Recombinant Human DCTPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCTPP1 Products
Required fields are marked with *
My Review for All DCTPP1 Products
Required fields are marked with *