Recombinant Human DCUN1D1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DCUN1D1-4659H
Product Overview : DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma and Scrotum Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2.
Molecular Mass : 30.1 kDa
AA Sequence : MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DCUN1D1 defective in cullin neddylation 1 domain containing 1 [ Homo sapiens (human) ]
Official Symbol DCUN1D1
Synonyms DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1;
Gene ID 54165
mRNA Refseq NM_020640
Protein Refseq NP_065691
MIM 605905
UniProt ID Q96GG9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCUN1D1 Products

Required fields are marked with *

My Review for All DCUN1D1 Products

Required fields are marked with *

0
cart-icon