Recombinant Human DCUN1D1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DCUN1D1-4659H |
Product Overview : | DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma and Scrotum Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2. |
Molecular Mass : | 30.1 kDa |
AA Sequence : | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DCUN1D1 defective in cullin neddylation 1 domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | DCUN1D1 |
Synonyms | DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1; |
Gene ID | 54165 |
mRNA Refseq | NM_020640 |
Protein Refseq | NP_065691 |
MIM | 605905 |
UniProt ID | Q96GG9 |
◆ Recombinant Proteins | ||
DCUN1D1-510H | Recombinant Human DCUN1D1 Protein, His-tagged | +Inquiry |
DCUN1D1-4371M | Recombinant Mouse DCUN1D1 Protein | +Inquiry |
DCUN1D1-197H | Recombinant Human DCUN1D1, His tagged | +Inquiry |
DCUN1D1-11871H | Recombinant Human DCUN1D1, GST-tagged | +Inquiry |
Dcun1d1-537M | Recombinant Mouse Dcun1d1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCUN1D1 Products
Required fields are marked with *
My Review for All DCUN1D1 Products
Required fields are marked with *
0
Inquiry Basket