Recombinant Human DCUN1D1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DCUN1D1-4659H
• Product Overview: DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma and Scrotum Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2.
• Molecular Mass: 30.1 kDa
• AA Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DCUN1D1 defective in cullin neddylation 1 domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: DCUN1D1
• Synonyms: DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1
• Gene ID: 54165
• mRNA Refseq: NM_020640
• Protein Refseq: NP_065691
• MIM: 605905
• UniProt ID: Q96GG9