Recombinant Human DCUN1D2, His-tagged
Cat.No. : | DCUN1D2-26557TH |
Product Overview : | Recombinant full length Human DCUN1D2 with an N terminal His tag; 279 amino acids including tag, Predicted MWt 32.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 259 amino acids |
Description : | May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity (By similarity). |
Conjugation : | HIS |
Molecular Weight : | 32.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 30% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF |
Sequence Similarities : | Contains 1 DCUN1 domain.Contains 1 UBA-like domain. |
Gene Name | DCUN1D2 DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCUN1D2 |
Synonyms | DCUN1D2; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); C13orf17, chromosome 13 open reading frame 17; DCN1-like protein 2; FLJ10704; FLJ20092; |
Gene ID | 55208 |
mRNA Refseq | NM_001014283 |
Protein Refseq | NP_001014305 |
Uniprot ID | Q6PH85 |
Chromosome Location | 13q34 |
◆ Recombinant Proteins | ||
DCUN1D2-1166H | Recombinant Human DCUN1D2 Protein, MYC/DDK-tagged | +Inquiry |
DCUN1D2-2419H | Recombinant Human DCUN1D2 Protein, GST-tagged | +Inquiry |
DCUN1D2-3620H | Recombinant Human DCUN1D2, His-tagged | +Inquiry |
DCUN1D2-4372M | Recombinant Mouse DCUN1D2 Protein | +Inquiry |
DCUN1D2-2411HF | Recombinant Full Length Human DCUN1D2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D2 Products
Required fields are marked with *
My Review for All DCUN1D2 Products
Required fields are marked with *