Recombinant Human DCUN1D2, His-tagged

Cat.No. : DCUN1D2-26557TH
Product Overview : Recombinant full length Human DCUN1D2 with an N terminal His tag; 279 amino acids including tag, Predicted MWt 32.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 259 amino acids
Description : May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity (By similarity).
Conjugation : HIS
Molecular Weight : 32.300kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 30% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
Sequence Similarities : Contains 1 DCUN1 domain.Contains 1 UBA-like domain.
Gene Name DCUN1D2 DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol DCUN1D2
Synonyms DCUN1D2; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); C13orf17, chromosome 13 open reading frame 17; DCN1-like protein 2; FLJ10704; FLJ20092;
Gene ID 55208
mRNA Refseq NM_001014283
Protein Refseq NP_001014305
Uniprot ID Q6PH85
Chromosome Location 13q34

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCUN1D2 Products

Required fields are marked with *

My Review for All DCUN1D2 Products

Required fields are marked with *

0
cart-icon
0
compare icon