Recombinant Human DCUN1D4 Protein, GST-tagged
Cat.No. : | DCUN1D4-2421H |
Product Overview : | Human DCUN1D4 full-length ORF ( ENSP00000263922, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DCUN1D4 (Defective In Cullin Neddylation 1 Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is DCUN1D5. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCUN1D4 DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCUN1D4 |
Synonyms | DCUN1D4; DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae); DCN1-like protein 4; KIAA0276; DCUN1 domain-containing protein 4; defective in cullin neddylation protein 1-like protein 4; FLJ42355; |
Gene ID | 23142 |
mRNA Refseq | NM_001040402 |
Protein Refseq | NP_001035492 |
MIM | 612977 |
UniProt ID | Q92564 |
◆ Recombinant Proteins | ||
DCUN1D4-2415HF | Recombinant Full Length Human DCUN1D4 Protein, GST-tagged | +Inquiry |
DCUN1D4-3376Z | Recombinant Zebrafish DCUN1D4 | +Inquiry |
DCUN1D4-1167H | Recombinant Human DCUN1D4 Protein, MYC/DDK-tagged | +Inquiry |
DCUN1D4-2350H | Recombinant Human DCUN1D4, His-tagged | +Inquiry |
Dcun1d4-166M | Recombinant Mouse Dcun1d4 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D4 Products
Required fields are marked with *
My Review for All DCUN1D4 Products
Required fields are marked with *