Recombinant Human DCUN1D4 Protein, GST-tagged
| Cat.No. : | DCUN1D4-2421H |
| Product Overview : | Human DCUN1D4 full-length ORF ( ENSP00000263922, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DCUN1D4 (Defective In Cullin Neddylation 1 Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is DCUN1D5. |
| Molecular Mass : | 49.8 kDa |
| AA Sequence : | MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCUN1D4 DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCUN1D4 |
| Synonyms | DCUN1D4; DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae); DCN1-like protein 4; KIAA0276; DCUN1 domain-containing protein 4; defective in cullin neddylation protein 1-like protein 4; FLJ42355; |
| Gene ID | 23142 |
| mRNA Refseq | NM_001040402 |
| Protein Refseq | NP_001035492 |
| MIM | 612977 |
| UniProt ID | Q92564 |
| ◆ Recombinant Proteins | ||
| Dcun1d4-166M | Recombinant Mouse Dcun1d4 Protein, MYC/DDK-tagged | +Inquiry |
| DCUN1D4-3376Z | Recombinant Zebrafish DCUN1D4 | +Inquiry |
| DCUN1D4-1167H | Recombinant Human DCUN1D4 Protein, MYC/DDK-tagged | +Inquiry |
| DCUN1D4-2415HF | Recombinant Full Length Human DCUN1D4 Protein, GST-tagged | +Inquiry |
| DCUN1D4-2421H | Recombinant Human DCUN1D4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D4 Products
Required fields are marked with *
My Review for All DCUN1D4 Products
Required fields are marked with *
