Recombinant Human DDAH2, His-tagged
| Cat.No. : | DDAH2-26260TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 71-261 of Human DDAH2 with N terminal His tag; MWt 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 71-261 a.a. |
| Description : | This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. |
| Conjugation : | HIS |
| Tissue specificity : | Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. |
| Form : | Lyophilised:Reconstitute with 53 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS |
| Sequence Similarities : | Belongs to the DDAH family. |
| Gene Name | DDAH2 dimethylarginine dimethylaminohydrolase 2 [ Homo sapiens ] |
| Official Symbol | DDAH2 |
| Synonyms | DDAH2; dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; |
| Gene ID | 23564 |
| mRNA Refseq | NM_013974 |
| Protein Refseq | NP_039268 |
| MIM | 604744 |
| Uniprot ID | O95865 |
| Chromosome Location | 6p21 |
| Function | amino acid binding; catalytic activity; dimethylargininase activity; hydrolase activity; protein binding; |
| ◆ Recombinant Proteins | ||
| DDAH2-2426HF | Recombinant Full Length Human DDAH2 Protein, GST-tagged | +Inquiry |
| DDAH2-4380M | Recombinant Mouse DDAH2 Protein | +Inquiry |
| DDAH2-3193H | Recombinant Human DDAH2 protein(1-285aa), His-GST-tagged | +Inquiry |
| DDAH2-1809R | Recombinant Rat DDAH2 Protein | +Inquiry |
| DDAH2-1203R | Recombinant Rhesus monkey DDAH2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDAH2-449HCL | Recombinant Human DDAH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDAH2 Products
Required fields are marked with *
My Review for All DDAH2 Products
Required fields are marked with *



