Recombinant Human DDAH2, His-tagged
Cat.No. : | DDAH2-26260TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 71-261 of Human DDAH2 with N terminal His tag; MWt 22kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. |
Form : | Lyophilised:Reconstitute with 53 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS |
Sequence Similarities : | Belongs to the DDAH family. |
Gene Name : | DDAH2 dimethylarginine dimethylaminohydrolase 2 [ Homo sapiens ] |
Official Symbol : | DDAH2 |
Synonyms : | DDAH2; dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; |
Gene ID : | 23564 |
mRNA Refseq : | NM_013974 |
Protein Refseq : | NP_039268 |
MIM : | 604744 |
Uniprot ID : | O95865 |
Chromosome Location : | 6p21 |
Function : | amino acid binding; catalytic activity; dimethylargininase activity; hydrolase activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
DDAH2-2429H | Recombinant Human DDAH2 Protein, GST-tagged | +Inquiry |
DDAH2-2250M | Recombinant Mouse DDAH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDAH2-1467R | Recombinant Rat DDAH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDAH2-1028R | Recombinant Rhesus Macaque DDAH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDAH2-2067H | Recombinant Human DDAH2 Protein (Ala31-Leu265), N-His tagged | +Inquiry |
◆ Lysates | ||
DDAH2-449HCL | Recombinant Human DDAH2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket