Recombinant Human DDAH2, His-tagged
Cat.No. : | DDAH2-26260TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 71-261 of Human DDAH2 with N terminal His tag; MWt 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-261 a.a. |
Description : | This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. |
Conjugation : | HIS |
Tissue specificity : | Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. |
Form : | Lyophilised:Reconstitute with 53 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS |
Sequence Similarities : | Belongs to the DDAH family. |
Gene Name | DDAH2 dimethylarginine dimethylaminohydrolase 2 [ Homo sapiens ] |
Official Symbol | DDAH2 |
Synonyms | DDAH2; dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; |
Gene ID | 23564 |
mRNA Refseq | NM_013974 |
Protein Refseq | NP_039268 |
MIM | 604744 |
Uniprot ID | O95865 |
Chromosome Location | 6p21 |
Function | amino acid binding; catalytic activity; dimethylargininase activity; hydrolase activity; protein binding; |
◆ Recombinant Proteins | ||
DDAH2-2426HF | Recombinant Full Length Human DDAH2 Protein, GST-tagged | +Inquiry |
DDAH2-11876H | Recombinant Human DDAH2, His-tagged | +Inquiry |
DDAH2-2067H | Recombinant Human DDAH2 Protein (Ala31-Leu265), N-His tagged | +Inquiry |
DDAH2-1467R | Recombinant Rat DDAH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDAH2-5853Z | Recombinant Zebrafish DDAH2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDAH2-449HCL | Recombinant Human DDAH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDAH2 Products
Required fields are marked with *
My Review for All DDAH2 Products
Required fields are marked with *