Recombinant Human DDIT3 Protein, GST-tagged
Cat.No. : | DDIT3-2442H |
Product Overview : | Human DDIT3 full-length ORF ( AAH03637.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. [provided by RefSeq, Aug 2010] |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ] |
Official Symbol | DDIT3 |
Synonyms | DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; c/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; growth arrest and DNA damage-inducible protein GADD153; CEBPZ; CHOP-10; MGC4154; |
Gene ID | 1649 |
mRNA Refseq | NM_001195053 |
Protein Refseq | NP_001181982 |
MIM | 126337 |
UniProt ID | P35638 |
◆ Recombinant Proteins | ||
DDIT3-4387M | Recombinant Mouse DDIT3 Protein | +Inquiry |
DDIT3-3639H | Recombinant Human DDIT3 protein, GST-tagged | +Inquiry |
Ddit3-1655M | Recombinant Mouse Ddit3 protein, His & GST-tagged | +Inquiry |
DDIT3-1206R | Recombinant Rhesus monkey DDIT3 Protein, His-tagged | +Inquiry |
DDIT3-26512TH | Recombinant Human DDIT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDIT3 Products
Required fields are marked with *
My Review for All DDIT3 Products
Required fields are marked with *
0
Inquiry Basket