Recombinant Human DDIT3 Protein, GST-tagged

Cat.No. : DDIT3-2442H
Product Overview : Human DDIT3 full-length ORF ( AAH03637.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. [provided by RefSeq, Aug 2010]
Molecular Mass : 45.6 kDa
AA Sequence : MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ]
Official Symbol DDIT3
Synonyms DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; c/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; growth arrest and DNA damage-inducible protein GADD153; CEBPZ; CHOP-10; MGC4154;
Gene ID 1649
mRNA Refseq NM_001195053
Protein Refseq NP_001181982
MIM 126337
UniProt ID P35638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDIT3 Products

Required fields are marked with *

My Review for All DDIT3 Products

Required fields are marked with *

0
cart-icon