Recombinant Human DDIT3 protein, GST-tagged
| Cat.No. : | DDIT3-3639H |
| Product Overview : | Recombinant Human DDIT3 protein(1-169 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | September 21, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-169 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ] |
| Official Symbol | DDIT3 |
| Synonyms | DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; c/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; growth arrest and DNA damage-inducible protein GADD153; CEBPZ; CHOP-10; MGC4154; |
| Gene ID | 1649 |
| mRNA Refseq | NM_001195053 |
| Protein Refseq | NP_001181982 |
| MIM | 126337 |
| UniProt ID | P35638 |
| ◆ Recombinant Proteins | ||
| Ddit3-1655M | Recombinant Mouse Ddit3 protein, His & GST-tagged | +Inquiry |
| DDIT3-5226Z | Recombinant Zebrafish DDIT3 | +Inquiry |
| DDIT3-3640H | Recombinant Human DDIT3 protein, His-tagged | +Inquiry |
| DDIT3-4387M | Recombinant Mouse DDIT3 Protein | +Inquiry |
| DDIT3-4948H | Recombinant Human DNA-Damage-Inducible Transcript 3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDIT3 Products
Required fields are marked with *
My Review for All DDIT3 Products
Required fields are marked with *
