Recombinant Human DDO Protein, GST-tagged
| Cat.No. : | DDO-2449H | 
| Product Overview : | Human DDO full-length ORF ( AAH32786, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 63.25 kDa | 
| AA Sequence : | MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DDO D-aspartate oxidase [ Homo sapiens ] | 
| Official Symbol | DDO | 
| Synonyms | DDO; D-aspartate oxidase; aspartic oxidase; D-aspartate oxidase, DDO; DASOX; DDO-1; DDO-2; FLJ45203; | 
| Gene ID | 8528 | 
| mRNA Refseq | NM_003649 | 
| Protein Refseq | NP_003640 | 
| MIM | 124450 | 
| UniProt ID | Q99489 | 
| ◆ Recombinant Proteins | ||
| DDO-1654C | Recombinant Cattle DDO protein, His-tagged | +Inquiry | 
| DDO-1324H | Recombinant Human DDO Protein, His-tagged | +Inquiry | 
| DDO-2449H | Recombinant Human DDO Protein, GST-tagged | +Inquiry | 
| DDO-4391M | Recombinant Mouse DDO Protein | +Inquiry | 
| DDO-157H | Recombinant Human DDO Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DDO-7025HCL | Recombinant Human DDO 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDO Products
Required fields are marked with *
My Review for All DDO Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            