Recombinant Human DDR1 protein, GST-tagged

Cat.No. : DDR1-1819H
Product Overview : Recombinant Human DDR1 protein(439-530 aa), fused to GST tag, was expressed in E. coli.
Availability September 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 439-530 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : WRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVP
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DDR1 discoidin domain receptor tyrosine kinase 1 [ Homo sapiens ]
Official Symbol DDR1
Synonyms DDR1; discoidin domain receptor tyrosine kinase 1; CAK, discoidin domain receptor family, member 1 , EDDR1, NEP, NTRK4, PTK3A; epithelial discoidin domain-containing receptor 1; CD167; RTK6; tyrosine kinase DDR; cell adhesion kinase; mammary carcinoma kinase 10; tyrosine-protein kinase CAK; protein-tyrosine kinase RTK-6; neuroepithelial tyrosine kinase; PTK3A protein tyrosine kinase 3A; CD167 antigen-like family member A; neurotrophic tyrosine kinase, receptor, type 4; CAK; DDR; NEP; HGK2; PTK3; TRKE; EDDR1; MCK10; NTRK4; PTK3A;
Gene ID 780
mRNA Refseq NM_001202521
Protein Refseq NP_001189450
MIM 600408
UniProt ID Q08345

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDR1 Products

Required fields are marked with *

My Review for All DDR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon