Recombinant Human DDR2 protein, His-tagged
| Cat.No. : | DDR2-3009H |
| Product Overview : | Recombinant Human DDR2 protein(291-398 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-398 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DDR2 discoidin domain receptor tyrosine kinase 2 [ Homo sapiens ] |
| Official Symbol | DDR2 |
| Synonyms | DDR2; discoidin domain receptor tyrosine kinase 2; discoidin domain receptor family, member 2 , NTRKR3, TYRO10; discoidin domain-containing receptor 2; TKT; tyrosylprotein kinase; hydroxyaryl-protein kinase; discoidin domain receptor 2; tyrosine-protein kinase TYRO10; CD167 antigen-like family member B; cell migration-inducing protein 20; migration-inducing gene 16 protein; receptor protein-tyrosine kinase TKT; discoidin domain receptor family, member 2; neurotrophic tyrosine kinase receptor related 3; neurotrophic tyrosine kinase, receptor-related 3; discoidin domain-containing receptor tyrosine kinase 2; MIG20a; NTRKR3; TYRO10; |
| Gene ID | 4921 |
| mRNA Refseq | NM_001014796 |
| Protein Refseq | NP_001014796 |
| MIM | 191311 |
| UniProt ID | Q16832 |
| ◆ Recombinant Proteins | ||
| DDR2-2646H | Active Recombinant Human DDR2 protein, His-tagged | +Inquiry |
| DDR2-759H | Recombinant Human DDR2 Protein, DDK/His-tagged | +Inquiry |
| DDR2-137H | Recombinant Human DDR2, None tagged | +Inquiry |
| DDR2-122R | Recombinant Rhesus DDR2 protein, His-tagged | +Inquiry |
| DDR2-2322H | Recombinant Human DDR2 protein(Met1-Arg399), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDR2-2172MCL | Recombinant Mouse DDR2 cell lysate | +Inquiry |
| DDR2-001HCL | Recombinant Human DDR2 cell lysate | +Inquiry |
| DDR2-1017CCL | Recombinant Cynomolgus DDR2 cell lysate | +Inquiry |
| DDR2-1033HCL | Recombinant Human DDR2 cell lysate | +Inquiry |
| DDR2-1296RCL | Recombinant Rat DDR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDR2 Products
Required fields are marked with *
My Review for All DDR2 Products
Required fields are marked with *
