Recombinant Human DDR2 protein, His-tagged

Cat.No. : DDR2-3009H
Product Overview : Recombinant Human DDR2 protein(291-398 aa), fused to His tag, was expressed in E. coli.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 291-398 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DDR2 discoidin domain receptor tyrosine kinase 2 [ Homo sapiens ]
Official Symbol DDR2
Synonyms DDR2; discoidin domain receptor tyrosine kinase 2; discoidin domain receptor family, member 2 , NTRKR3, TYRO10; discoidin domain-containing receptor 2; TKT; tyrosylprotein kinase; hydroxyaryl-protein kinase; discoidin domain receptor 2; tyrosine-protein kinase TYRO10; CD167 antigen-like family member B; cell migration-inducing protein 20; migration-inducing gene 16 protein; receptor protein-tyrosine kinase TKT; discoidin domain receptor family, member 2; neurotrophic tyrosine kinase receptor related 3; neurotrophic tyrosine kinase, receptor-related 3; discoidin domain-containing receptor tyrosine kinase 2; MIG20a; NTRKR3; TYRO10;
Gene ID 4921
mRNA Refseq NM_001014796
Protein Refseq NP_001014796
MIM 191311
UniProt ID Q16832

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDR2 Products

Required fields are marked with *

My Review for All DDR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon