Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DDT-3434H |
| Product Overview : | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. |
| Molecular Mass : | 12.7 kDa |
| AA Sequence : | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DDT D-dopachrome tautomerase [ Homo sapiens (human) ] |
| Official Symbol | DDT |
| Synonyms | DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842; |
| Gene ID | 1652 |
| mRNA Refseq | NM_001355 |
| Protein Refseq | NP_001346 |
| MIM | 602750 |
| UniProt ID | P30046 |
| ◆ Recombinant Proteins | ||
| DDT-1815R | Recombinant Rat DDT Protein | +Inquiry |
| DDT-1473R | Recombinant Rat DDT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ddt-2498M | Recombinant Mouse Ddt Protein, Myc/DDK-tagged | +Inquiry |
| DDT-2260M | Recombinant Mouse DDT Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDT-1312C | Recombinant Cynomolgus DDT protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *
