Recombinant Human DDX17, GST-tagged
| Cat.No. : | DDX17-85H |
| Product Overview : | Recombinant Human DDX17 (1 a.a. - 183 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. This gene can encode multiple isoforms due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) start codon. |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MQLVDHRGGGGGGGKGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGS PNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQ FAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DDX17 DEAD (Asp-Glu-Ala-Asp) box helicase 17 [ Homo sapiens(human) ] |
| Official Symbol | DDX17 |
| Synonyms | DDX17; P72; RH70; DEAD (Asp-Glu-Ala-Asp) box helicase 17; probable ATP-dependent RNA helicase DDX17; DEAD box protein p72; RNA-dependent helicase p72; DEAD (Asp-Glu-Ala-Asp) box polypeptide 17; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD); NP_001091974.1; EC 3.6.4.13; NP_006377.2 |
| Gene ID | 10521 |
| mRNA Refseq | NM_006386 |
| Protein Refseq | NP_006377 |
| MIM | 608469 |
| UniProt ID | Q92841 |
| Chromosome Location | 22q13.1 |
| Function | ATP binding; ATP-dependent helicase activity; RNA helicase activity |
| ◆ Recombinant Proteins | ||
| DDX17-4400M | Recombinant Mouse DDX17 Protein | +Inquiry |
| DDX17-1039HFL | Recombinant Full Length Human DDX17 Protein, C-Flag-tagged | +Inquiry |
| Ddx17-2499M | Recombinant Mouse Ddx17 Protein, Myc/DDK-tagged | +Inquiry |
| DDX17-85H | Recombinant Human DDX17, GST-tagged | +Inquiry |
| DDX17-739H | Recombinant Human DDX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX17-7020HCL | Recombinant Human DDX17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX17 Products
Required fields are marked with *
My Review for All DDX17 Products
Required fields are marked with *
