Recombinant Human DDX28 Protein, GST-tagged
Cat.No. : | DDX28-2481H |
Product Overview : | Human DDX28 full-length ORF ( NP_060850.1, 1 a.a. - 540 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is intronless. It encodes an RNA-dependent ATPase. The encoded protein is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 86 kDa |
AA Sequence : | MALARPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSRRARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX28 DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 [ Homo sapiens ] |
Official Symbol | DDX28 |
Synonyms | DDX28; DEAD (Asp-Glu-Ala-Asp) box polypeptide 28; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 28; probable ATP-dependent RNA helicase DDX28; FLJ11282; MDDX28; mitochondrial DEAD box protein 28; mitochondrial DEAD-box polypeptide 28; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 28; |
Gene ID | 55794 |
mRNA Refseq | NM_018380 |
Protein Refseq | NP_060850 |
MIM | 607618 |
UniProt ID | Q9NUL7 |
◆ Recombinant Proteins | ||
DDX28-2270M | Recombinant Mouse DDX28 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX28-2569HF | Recombinant Full Length Human DDX28 Protein, GST-tagged | +Inquiry |
DDX28-456C | Recombinant Cynomolgus DDX28 Protein, His-tagged | +Inquiry |
DDX28-2481H | Recombinant Human DDX28 Protein, GST-tagged | +Inquiry |
DDX28-202C | Recombinant Cynomolgus Monkey DDX28 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX28-7011HCL | Recombinant Human DDX28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX28 Products
Required fields are marked with *
My Review for All DDX28 Products
Required fields are marked with *
0
Inquiry Basket